PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT25955
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 199aa    MW: 21995 Da    PI: 5.3023
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT25955genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.72.6e-1386125647
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++Ed l+v++ + +G++ W+tIa+ +  gRt++ +k+rw+++
         EMT25955  86 EQEDMLIVKYQATYGNR-WSTIAEFLS-GRTDNAIKNRWNSV 125
                      68***************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001678.41E-1176126No hitNo description
PROSITE profilePS5129414.99780130IPR017930Myb domain
SMARTSM007174.3E-1080128IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-1686126IPR009057Homeodomain-like
PfamPF002493.8E-1186126IPR001005SANT/Myb domain
SuperFamilySSF466891.35E-1286130IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MSRCVWALEE EHMLSALSEI CDTGCRIGHV HEEQQETKAI QARGMVMSPS SFPATSVSDA  60
VASDGDGLPH AAKKMWTKRE DDLLREQEDM LIVKYQATYG NRWSTIAEFL SGRTDNAIKN  120
RWNSVLHKHA PSLQAETCAT ARECLEMFPL APGDIRANAA AAAPPSDMTC GVGDPLTELR  180
LWSAARVVFD VMPLQAYRM
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519197e-74JF951919.1 Triticum aestivum clone TaMYB21 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561848.14e-34PREDICTED: transcription factor MYB23-like
TrEMBLM8BLT41e-149M8BLT4_AEGTA; Uncharacterized protein
STRINGMLOC_63274.12e-66(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.11e-12myb domain protein 73